| Product Number |
ARP79623_P050 |
| Product Page |
staging.avivasysbio.com/gsdmd-antibody-middle-region-arp79623-p050.html |
| Name |
GSDMD Antibody - middle region (ARP79623_P050) |
| Protein Size (# AA) |
484 amino acids |
| Molecular Weight |
53 kDa |
| NCBI Gene Id |
79792 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
gasdermin D |
| Alias Symbols |
DF5L, DFNA5L, FKSG10, GSDMDC1 |
| Peptide Sequence |
Synthetic peptide located within the following region: VTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Gasdermin D is a member of the gasdermin family. Members of this family appear to play a role in regulation of epithelial proliferation. Gasdermin D has been suggested to act as a tumor suppressor. Alternatively spliced transcript variants have been described. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GSDMD (ARP79623_P050) antibody |
| Blocking Peptide |
For anti-GSDMD (ARP79623_P050) antibody is Catalog # AAP79623 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GSDMD |
| Uniprot ID |
P57764 |
| Protein Name |
gasdermin-D |
| Protein Accession # |
NP_001159709.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001166237.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GSDMD |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Leiomyosarcoma Tumor
 | Host: Rabbit
Target Name: GSDMD
Sample Tissue: Human Leiomyosarcoma Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
