TFEB Antibody - middle region : FITC (ARP58116_P050-FITC)

Data Sheet
 
Product Number ARP58116_P050-FITC
Product Page staging.avivasysbio.com/tfeb-antibody-middle-region-fitc-arp58116-p050-fitc.html
Name TFEB Antibody - middle region : FITC (ARP58116_P050-FITC)
Protein Size (# AA) 476 amino acids
Molecular Weight 53kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 7942
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor EB
Alias Symbols TCFEB, BHLHE35, ALPHATFEB
Peptide Sequence Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.
Protein Interactions SRPK1; YWHAQ; TFEC; TFE3; MITF;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-TFEB (ARP58116_P050-FITC) antibody
Blocking Peptide For anti-TFEB (ARP58116_P050-FITC) antibody is Catalog # AAP58116 (Previous Catalog # AAPP32549)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TFEB
Uniprot ID P19484
Protein Name Transcription factor EB
Protein Accession # NP_009093
Purification Affinity Purified
Nucleotide Accession # NM_007162
Gene Symbol TFEB
Predicted Species Reactivity Human, Cow, Dog, Goat, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Goat: 79%; Horse: 85%; Human: 100%; Rabbit: 86%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com