Product Number |
ARP58116_P050-Biotin |
Product Page |
staging.avivasysbio.com/tfeb-antibody-middle-region-biotin-arp58116-p050-biotin.html |
Name |
TFEB Antibody - middle region : Biotin (ARP58116_P050-Biotin) |
Protein Size (# AA) |
476 amino acids |
Molecular Weight |
53kDa |
Conjugation |
Biotin |
NCBI Gene Id |
7942 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transcription factor EB |
Alias Symbols |
TCFEB, BHLHE35, ALPHATFEB |
Peptide Sequence |
Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms. |
Protein Interactions |
SRPK1; YWHAQ; TFEC; TFE3; MITF; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-TFEB (ARP58116_P050-Biotin) antibody |
Blocking Peptide |
For anti-TFEB (ARP58116_P050-Biotin) antibody is Catalog # AAP58116 (Previous Catalog # AAPP32549) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TFEB |
Uniprot ID |
P19484 |
Protein Name |
Transcription factor EB |
Protein Accession # |
NP_009093 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007162 |
Gene Symbol |
TFEB |
Predicted Species Reactivity |
Human, Cow, Dog, Goat, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Goat: 79%; Horse: 85%; Human: 100%; Rabbit: 86% |
Image 1 | |
|