| Product Number |
ARP58116_P050 |
| Product Page |
staging.avivasysbio.com/tfeb-antibody-middle-region-arp58116-p050.html |
| Name |
TFEB Antibody - middle region (ARP58116_P050) |
| Protein Size (# AA) |
476 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
7942 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription factor EB |
| Alias Symbols |
TCFEB, BHLHE35, ALPHATFEB |
| Peptide Sequence |
Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms. |
| Protein Interactions |
SRPK1; YWHAQ; TFEC; TFE3; MITF; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TFEB (ARP58116_P050) antibody |
| Blocking Peptide |
For anti-TFEB (ARP58116_P050) antibody is Catalog # AAP58116 (Previous Catalog # AAPP32549) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TFEB |
| Uniprot ID |
P19484 |
| Protein Name |
Transcription factor EB |
| Protein Accession # |
NP_009093 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007162 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TFEB |
| Predicted Species Reactivity |
Human, Cow, Dog, Goat, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Goat: 79%; Horse: 85%; Human: 100%; Rabbit: 86% |
| Image 1 | Human PANC1
 | WB Suggested Anti-TFEB Antibody Titration: 0.2-1 ug/ml
Positive Control: PANC1 cell lysate |
|
| Image 2 | Human Adult Placenta
 | Host: Rabbit
Target Name: TFEB
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human Fetal Muscle
 | Host: Rabbit
Target Name: TFEB
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml |
|
| Image 4 | Human Fetal Heart
 | Host: Rabbit
Target Name: TFEB
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml |
|
