| Product Number |
ARP38810_T100-Biotin |
| Product Page |
staging.avivasysbio.com/tfeb-antibody-c-terminal-region-biotin-arp38810-t100-biotin.html |
| Name |
TFEB Antibody - C-terminal region : Biotin (ARP38810_T100-Biotin) |
| Protein Size (# AA) |
476 amino acids |
| Molecular Weight |
53kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
7942 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription factor EB |
| Alias Symbols |
TCFEB, BHLHE35, ALPHATFEB |
| Peptide Sequence |
Synthetic peptide located within the following region: SLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Argani,P., et al., (2005) Am. J. Surg. Pathol. 29 (2), 230-240 |
| Description of Target |
TFEB is a member of the basic Helix-Loop-Helix-Zipper family of transcription factors. TFEB can bind DNA as a homodimer or as a heterodimer with three closely related family members: MITF, TFE3 and TFEC. The t(6;11)(p21;q12), a translocation recently been shown to result in fusion of Alpha, a gene on 11q12, with the transcription factor gene TFEB on 6p21.This translocation ultimately leads to the development of Renal carcinomas. |
| Protein Interactions |
SRPK1; YWHAQ; TFEC; TFE3; MITF; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-TFEB (ARP38810_T100-Biotin) antibody |
| Blocking Peptide |
For anti-TFEB (ARP38810_T100-Biotin) antibody is Catalog # AAP38810 (Previous Catalog # AAPP21019) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TFEB |
| Uniprot ID |
P19484 |
| Protein Name |
Transcription factor EB |
| Protein Accession # |
NP_009093 |
| Nucleotide Accession # |
NM_007162 |
| Gene Symbol |
TFEB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Yeast: 100%; Zebrafish: 91% |
| Image 1 | |
|
